Sermorelin 2mg

182 customer reviews

$23.50

Sermorelin 2mg

Availability: Expedited shipping if ordered and paid by 12 PM MT

Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.

Description

Sermorelin: A History and Overview

Sermorelin, a synthetic peptide comprising the first 29 amino acids of the naturally occurring growth hormone-releasing hormone (GHRH), is designed to increase the production of growth hormone (GH) in the pituitary gland. As a truncated version of GHRH, Sermorelin is utilized in various therapeutic settings, particularly in diagnosing and treating growth hormone deficiency (GHD) in children and adults.

Sermorelin Chemical Composition

  • CAS No: 86168-78-7
  • Chemical Name: Sermorelin is also known as GRF 1-29, reflecting its composition as the first 29 amino acids of the naturally occurring human growth hormone-releasing hormone.
  • Synonyms: SERMORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN; growth hormone releasing factor*fragment 1-29 ami;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: Approximately 3357.88 g/mol
  • EINECS: 1312995-182-4
  • MOL File: 86168-78-7.mol
  • Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Amino Acid Count: 29, representing the first 29 of the 44 amino acids found in the naturally occurring GHRH.
  • Biological Half-life: Sermorelin has a short half-life, which necessitates its frequent administration when used clinically to stimulate growth hormone release.
  • Function: It specifically binds to the growth hormone-releasing hormone receptor (GHRHR) on cells in the anterior pituitary gland, stimulating the production and release of growth hormone (GH).
  • Use: Clinically, Sermorelin has been used as a diagnostic agent to assess growth hormone secretion for the diagnosis of pituitary dwarfism and as a therapeutic agent to increase growth hormone levels in children with growth hormone deficiency.
  • Administration: It is typically administered via subcutaneous injection.
  • Pharmacokinetics: Due to its short half-life, Sermorelin exhibits rapid onset and dissipation of effect, which mimics the natural pulsatile release of growth hormone.
  • Shelf Life: 36 months
  • Appearance: White lipolyzed powder puck.

Sermorelin 2mgMechanism of Action

Sermorelin works by mimicking the effects of GHRH, the endogenous hormone responsible for stimulating growth hormone release from the pituitary gland. By binding to the GHRH receptors on the pituitary gland, Sermorelin promotes the secretion of endogenous GH, which in turn supports growth and development, metabolic functions, and overall health.

Clinical Applications

Growth Hormone Deficiency in Children

In pediatric patients, Sermorelin is prescribed to evaluate pituitary function and to treat GHD, a condition characterized by insufficient growth and development due to inadequate GH production. Treatment with Sermorelin has been shown to effectively stimulate GH release, supporting normal growth rates in children diagnosed with GHD.

Adult Growth Hormone Deficiency

Sermorelin therapy is also applicable in adults experiencing GHD, a condition that can lead to decreased muscle mass, increased body fat, decreased bone density, and a reduced quality of life. By stimulating the natural production of GH, Sermorelin can help mitigate these symptoms, improving body composition and physical well-being.

Benefits

Sermorelin therapy offers several benefits, including increased lean body mass, decreased body fat, improved bone density, enhanced energy levels, and an overall improvement in the quality of life. Additionally, because Sermorelin stimulates the body’s natural GH production, it presents a lower risk of adverse effects compared to direct GH supplementation.

Potential Side Effects

While Sermorelin is generally well-tolerated, some individuals may experience side effects such as injection site reactions, headaches, dizziness, flushing, and hyperactivity of the pituitary gland. It’s important for patients to be closely monitored by their healthcare provider during treatment.

ghrh sermorelin mod grf cjc1295 tesamorelin

Conclusion

Sermorelin represents a valuable therapeutic option for individuals with GH deficiencies, offering a means to naturally enhance GH levels and improve physiological functions and well-being. With its targeted mechanism of action and favorable safety profile, Sermorelin therapy continues to play a critical role in endocrinology and hormone replacement therapy.

Referenced Citations

  1. Use in Idiopathic Growth Hormone Deficiency: A study highlighted on PubMed discusses Sermorelin’s role in diagnosing and treating children with idiopathic growth hormone deficiency. It was found effective when administered intravenously in conjunction with conventional tests, showing potential in promoting growth in prepubertal children with this condition. (https://pubmed.ncbi.nlm.nih.gov/18031173/)
  2. Immune System Effects: Research in 1997 examined Sermorelin’s impact on the immune system of aging men and women, finding a “profound immune-enhancing effect” and suggesting therapeutic benefits in compromised immune function. (https://www.invigormedical.com/anti-aging/conclusions-of-sermorelin-studies/)
  3. Reversing Decreased Growth Hormone Levels in Older Men: An early study following Sermorelin’s clinical approval investigated its ability to reverse the natural decline in growth hormone levels in aging men. The study suggested that long-term treatment could mitigate age-related body changes. (https://www.invigormedical.com/anti-aging/conclusions-of-sermorelin-studies/)
  4. Effects on Muscle Composition and Metabolism: Another study from 1997 found that GHRH analogs like Sermorelin may help reverse muscle composition, metabolism, and skeletal-related problems typically associated with aging. (https://www.invigormedical.com/anti-aging/conclusions-of-sermorelin-studies/)
  5. Cardiovascular Function Improvement: Research has indicated potential benefits of Sermorelin for cardiovascular function, noting that aging is associated with increased cardiovascular risks, which IGF-1 and growth hormone treatments could mitigate. (https://www.invigormedical.com/performance/sermorelin-benefits-for-men-women/)
  6. Shortens Recovery Time: It has been shown that human growth hormone, which Sermorelin stimulates the release of, can increase tissue growth, especially in bones and cartilage, and shorten recovery time. (https://www.invigormedical.com/performance/sermorelin-benefits-for-men-women/)
  7. Improves Sleep: A study from 1995 observed that taking a growth-hormone secretagogue like Sermorelin increased growth hormone levels and improved sleep patterns without negatively impacting slow-wave sleep time. (https://www.invigormedical.com/performance/sermorelin-benefits-for-men-women/)
Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.

Recently Viewed Products

You haven't viewed at any of the products yet.

You’re reviewing:  

Be the first to know

Receive all the latest information on events, sales, & offers.
SigmaLabsUS.com